Disrupting the ure2 operon has no effect on urease activity, or pathogen survival in BALB/c mice when inoculated by gavage, but confers slightly enhanced resistance to low pH killing in vitro.

Belongs to the urease gamma subunit family.

100 amino acids

MHLTPREFDKLVIHMLSDVALKRKNKGLKLNHPEAVAVLSAYVLDGAREGKTVEEVMDGARSVLKADDVMDGVPDLLPLIQVEAVFSDGSRLVSLHNPIT

10.9 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make ureA2 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here