Disrupting the ure1 operon causes loss of urease activity, decreased resistance to low pH killing in vitro and decreased pathogen survival when inoculated in BALB/c mice by gavage.

Belongs to the UreF family.

228 amino acids

MIIITPITNDPTTALLRLMAWLSPVFPVGSFSYSHGLERAVHDGLVVDAAGLQDWLQWLVRRGSGWNDAVLCAESWRCAMKGEDLHEIAELAEALAGSRERHMETMLQGGAFLAAARSWPCEIFDRLPPDCAYPVAVGAVAGGHGVPLAQALAAFLQAFCINLLQASIRLSVTGQSGVTAIMAALEPVLGETAARAALSSMEDLGSATFIADIMAMKHETQHSRLFRS

24.4 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make ureF1 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here