Disruption of the ure1 gene cluster suggests that it protects brucellae during their passage through the stomach. The major route of infection in human brucellosis is oral.

Belongs to the UreE family.

171 amino acids

MFRAIAIIRAHEVIDAVPASHIVLERDERHLRRKAITLENGEKILADFAEPVVLEHGDRLVLDDGREIEIRAASEELYEIRGRDPRHIAELAWHIGNRHLAAQIETDHIFILRDHVIRVMLEGLGATVTDVVAIFSPLRGAYSGGHQHHHGHDHDHGHHGHDHDHHHPDHE

19.5 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make ureE1 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here