Catalyzes the conversion of uracil and 5-phospho-alpha-D-ribose 1-diphosphate (PRPP) to UMP and diphosphate.

Belongs to the UPRTase family.

216 amino acids

MSSEPFKNVYLLPQTNQLLGLYTIIRDKKTKRPDFVFYSDRIIRLLVEEGLNHLPVTPNTVETDTNQSFDGVSFLGKICGVSIVRAGESMEQGLRDCCRSVRIGKILIQRDEETALPKLFYEKLPDDIADRFVFLLDPMLATGGSAIMATEVLIKRGVKPERIFFLNLICSKEGIENYHAKFPTIKIVTGALDKGLDANRYLIPGLGDFGDRYYCI

24.4 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make FUR1 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here