To A.rhizogenes plasmid pRia4B ORF-3 in virA region.

194 amino acids

MVASVVRLKVTLDHVEPIVMRRVVVPFTIRLSRLHEVLQAAMGWTNSHLYEFRMRDVGFGLPDEEWGDGPIDARRVSLLSAVQDTGAKSFKYLYDFGDGWEHSIKIERTFPAVGTEGPMLLEATGHCPPEDVGGPWGYQEFCEALADPAHERHAETLEWCGSSDYDSAAANFSQLNKAVDDLAAKWARKARRKT

21.7 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make NGR_a03330 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here