About Products Protein Database Contact

Protein expression services for MIMI_R642 | Uncharacterized protein R642

Species
Acanthamoeba polyphaga mimivirus
Length
220 amino acids
Sequence
MLLENQLYLQRNFVGYCQKGDAVRKLRYNYRENVDYADLSYDEMNNCDEILALANPIANRGSHNKRFIFLTKFAAYSFIIECQTLKAKEIRCHVIDVYNKYHELLMYCKQKNSQKNFEQSKNDAVKLYQIREDNKHQEYKKQKNREIKAIKETTEEIRRQKDMYKEKYCKLEYEVKKYKQLYKELEHKVDNGKNKLKKLSNEITDNSLKRKIKKEINGLC
Mass
26.6 kDa
Simulated SDS-PAGE
Western blot of MIMI_R642 recombinant protein(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make MIMI_R642 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here