Belongs to the chlamydial CPn_0422/CT_273/TC_0545 family.

181 amino acids

MVEIFNYSTSIYEQHASNNRIVSDFRKEIQMEGISIRDVAKHAQILDMNPKPSALTSLLQTNQKSHWACFSPPNNFYKQRFSTPYLAPSLGSPDQQDEDIEKISSFLKVLTRGKFSYRSQITPFLSYKDKEEEEDEDPEEDDDDPRVQQGKVLLKALDLGVKSTNVMIDYVISRIFQFVQG

20.9 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make CPn_0422 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here