About Products Protein Database Contact

Protein expression services for ubl4a | Ubiquitin-like protein 4A

Description
As part of a cytosolic protein quality control complex, the bag6/bat3 complex, maintains misfolded and hydrophobic patches-containing proteins in a soluble state and participates to their proper delivery to the endoplasmic reticulum or alternatively can promote their sorting to the proteasome where they undergo degradation. The bag6/bat3 complex is involved in the post-translational delivery of tail-anchored/type II transmembrane proteins to the endoplasmic reticulum membrane. Similarly, the bag6/bat3 complex also functions as a sorting platform for proteins of the secretory pathway that are mislocalized to the cytosol either delivering them to the proteasome for degradation or to the endoplasmic reticulum. The bag6/bat3 complex also plays a role in the endoplasmic reticulum-associated degradation (ERAD), a quality control mechanism that eliminates unwanted proteins of the endoplasmic reticulum through their retrotranslocation to the cytosol and their targeting to the proteasome. It maintains these retrotranslocated proteins in an unfolded yet soluble state condition in the cytosol to ensure their proper delivery to the proteasome.
Species
Anoplopoma fimbria
Length
156 amino acids
Sequence
MILTVKPLQGKECSVQVTEDEKVSTVKELVSERLNIPANQQRLLYKGKALSDEHRLSDYSIGPEAKLNLVIRPVGERTGASGTAASSSSSSQGRVWQTVSTILARHFSPADAAKVHEQLIKDYERSLRQLSLDDIERLAGRLLHPDGEGMDTSYMD
Mass
17.2 kDa
Simulated SDS-PAGE
Western blot of ubl4a recombinant protein(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make ubl4a using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here