Catalyzes the covalent attachment of ubiquitin to other proteins. Acts as an essential factor of the anaphase promoting complex/cyclosome (APC/C), a cell cycle-regulated ubiquitin ligase that controls progression through mitosis. Acts by specifically elongating 'Lys-11'-linked polyubiquitin chains initiated by the E2 enzyme ube2c/ubch10 on APC/C substrates, enhancing the degradation of APC/C substrates by the proteasome and promoting mitotic exit.

Belongs to the ubiquitin-conjugating enzyme family.

221 amino acids

MNSNVENLPPQVLRLVYKEVSALAADPPEGIKIYPSEEDITELHTSIEGPEGTPYAGGVFRMRLVLGKDFPAVPPRGYFLTKIFHPNVGHKGEICVNVLKRDWKAELGLRHVLLTIKCLLIHPNPESALNEEAGKLLLEDYKEYASRAHLLTEIHAMGGTSGAPQEPADGPQPKKHAGDPNKRVVGAGLPTMGTGTNNSNISNTNIVAKKKTDKKRALRRL

24.1 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make ube2s using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here