Component of the coenzyme Q biosynthetic pathway. May play a role in organizing a multi-subunit COQ enzyme complex required for coenzyme Q biosynthesis. Required for steady-state levels of other COQ polypeptides.

Belongs to the COQ4 family.

268 amino acids

MMQRCLRLPKLLALRRDLHLAQVERQAVVTEAPEAEPQDAFERQYFKERIEISPFQRVFLAAGSSIAALLDPRRHDMIACLGETTGEDALWTILDSMQASEEGQRIMADKPRIHTSTIDFKYLETLPPDTFGAAYVKFLKDNQVTPDSRMAVRFLEEPKLAYLMTRYRECHDLIHTVLDMPTNMLGEVSVKWVEALNTGLPMCYGGAVFGAVRLRPKQRRAYLKHYLPWALENGKRTKPLMPVYWEKRWEQNIHDLRSELGITVLNKA

31 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make GG15811 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here