May be involved in control of cell division, especially during the resumption from cell cycle arrest.

Belongs to the BolA/IbaG family.

102 amino acids

MIRRFFHTMGRQDRIYKTLSEALKTDKITLYNDSYKHSHHIAMKGVPDTNETHFRLEIVSPEFSGMSRVARHRLVYGLLKDEFDGGLHALQITSSKTPDEVS

11.8 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make uvi31 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here