Catalyzes the formation of UDP-glucose from glucose-1-phosphate and UTP. This is an intermediate step in the biosynthesis of diglucosyl-diacylglycerol (Glc2-DAG), i.e. a glycolipid found in the membrane, which is also used as a membrane anchor for lipoteichoic acid (LTA) (By similarity).

Belongs to the UDPGP type 2 family.

289 amino acids

MRKIKKAIIPAAGLGTRFLPATKAMPKEMLPILDKPTIQYIVEEAARAGIEDIIIVTGKHKRAIEDHFDNQKELEMILQEKGKTDLLEKVKYSTELANIFYVRQKEQKGLGHAIYSARQFIGDEPFAVLLGDDIVESDNPAIKQLIEAYEETGKSVIGVQEVDEAQTHRYGIIDPLQKFGRKYEVNEFVEKPKQGTAPSNLAIMGRYVLTPDIFDYLATQGEGAGGEIQLTDAIERLNRADQVYAYDFEGDRYDVGEKLGFVKTTIEYALKDESMHDELVEFIKKLKLN

32.7 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make gtaB2 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here