About Products Protein Database Contact

Try expressing SERP0997 in cell-free | UPF0346 protein SERP0997

Family
Belongs to the UPF0346 family.
Species
Staphylococcus epidermidis (strain ATCC 35984 / RP62A)
Length
74 amino acids
Sequence
MVKNYSFYQFIMTVRGRKDDKGVFAEQIFEDLAFPKHEDDFNTLSEYIETHSEFTLPMSVFDDLYDDYTEWLKF
Mass
9 kDa
Simulated SDS-PAGE
Western blot of SERP0997 recombinant protein(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Cell-Free protein synthesis
Have you tried producing SERP0997 in a cell-free protein expression systems? We have solved cell-free protein expression scale-up and purification challenges so that you can obtain up to low-milligram quantities of proteins in hours.

Order Here