Catalyzes the biosynthesis of UDP-sulfoquinovose by the transfer of sulfite to UDP-glucose (PubMed:22059775, PubMed:25605538). Important for the assembly of the S-layer N-glycans (PubMed:22059775). The reaction probably occurs through an NAD(+)-dependent oxidation/dehydration/enolization/sulfite addition process (PubMed:25605538). In vitro, in the absence of sulfite, UDP-D-glucose is converted via UDP-4-keto-D-glucose to UDP-D-glucose-5,6-ene (PubMed:25605538).

Belongs to the NAD(P)-dependent epimerase/dehydratase family.

393 amino acids

MRILVLGIDGHLGWPLALRLAKRGHEVIGIDNLSTRRFSEEVGSDSAFPLPQPQERVSEAKKHLGVDITFYVGDITNYGFFKDIVQRYKPDAIVHFAEQRSAPYSMIDMDHAVYTVINNEVSTLRVIQAVLEVDPTIHILKMGTMGEYGTPAFDIPESIYVEAIVNGKKDKIIVPRKAGSVYHWTKVHDTDFLLHFQELYGLTVTDIMQGPVYGTRTEEIVEETLRTRFDFDEVWGTVVNRYCVEAILGLPLTVYGKGGQTRGFISLEDSIQALTLLLENPPKQGEYRVANQFAEIYSVKKIAEFVKKAGEELGLNVEIGSYENPRVEAEEHYYNPERKVLPSLGFYPKKRLPEDVKIMIKDLLPYKTRLERFKHVILPKTKWRKPQYVKRVR

45 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make agl3 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here