UDPGT is of major importance in the conjugation and subsequent elimination of potentially toxic xenobiotics and endogenous compounds. Catalyzes the transfer of glucuronic acid from UDP-glucuronic acid to various aglycone molecules. Catalyzes the glucuronidation of monoterpenoid alcohols, such as (-)-borneol, (+)-menthol, and (-)- nopol. In addition, a number of simple phenolic compounds, such as hydroxybiphenyls, 7-hydroxylated coumarins, p-nitrophenol, and food-derived substances (e.g. naringenin and eugenol), and 4-methylumbelliferone are also substrates.

Belongs to the UDP-glycosyltransferase family.

530 amino acids

MSGKWISALLLLQISFCFKSGNCGKVLVWPMEYSHWMNIKIILEELVQKGHEVTVLRPSAFVFLDPKETSDLKFVTFPTSFSSHDLENFFTRFVNVWTYELPRDTCLSYFLYLQDTIDEYSDYCLTVCKEAVSNKQFMTKLQESKFDVVFSDAIGPCGELIAELLQIPFLYSLRFSPGYTIEQYIGGVLFPPSYVPMIFSGLAGQMTFIERVHNMICMLYFDFWFQTFREKKWDPFYSKTLGRPTTLAEIMGKAEMWLIRSYWDLEFPHPISPNVDYIGGLHCKPAKPLPKDIEDFVQSSGEHGVVVFSLGSMVRNMTEEKANIIAWALAQIPQKVLWRFDGKKPPTLGPNTRLYKWLPQNDLLGHPKTKAFVTHGGANGIYEAIHHGIPMIGIPLFAEQHDNIAHMVAKGAAVEVNFRTMSKSDLLNALEEVIDNPFYKKNAMWLSTIHHDQPTKPLDRAVFWIEFVMRHKGAKHLRSLGHNLPWYQYHSLDVIGFLLSCVAVTVVLALKCFLFVYRFFVKKEKKTKNE

61.1 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make Ugt2b15 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here