UDP-L-arabinose mutase involved in the biosynthesis of cell wall non-cellulosic polysaccharides. Catalyzes the interconvertion of UDP-L-arabinopyranose (UDP-Arap) and UDP-L-arabinofuranose (UDP-Araf). Preferentially catalyzes the formation of UDP-Arap from UDP-Araf. At thermodynamic equilibrium in vitro the ratio of the pyranose form over the furanose form is 90:10. Is probably active as heteromer in vivo.

Belongs to the RGP family.

366 amino acids

MASSDAAAAQAATPLLKDELDIVIPTIRNLDFLEMWRPFFQPYHLIIVQDGDPKKTIRVPEGFDYELYNRDDINRILGPRASCISFKDSACRCFGYMVSKKKYIYTIDDDCFVAKDPSGKDINALEQHIKNLLNPSTPFFFNTLYDPYRDGADFVRGYPFSLREGAPTAVSHGLWLNIPDYDAPTQLVKPLERNSRYVDAVMTIPKGTLFPMCGMNLAFDRDLIGPAMYFGLMGDGQPIGRYDDMWAGWCTKVITDHLGLGVKTGLPYIWHSKASNPFVNLKKEYNGIFWQEELIPFFQSASLPKEADTVQKCYLELAKQVRAKLGKVDGYFNKLADSMVTWIEAWDQLNPPKGAVATANGTAKSK

41.3 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make UAM3 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here