Catalyzes the addition of meso-diaminopimelic acid to the nucleotide precursor UDP-N-acetylmuramoyl-L-alanyl-D-glutamate (UMAG) in the biosynthesis of bacterial cell-wall peptidoglycan.

Belongs to the MurCDEF family. MurE subfamily.

521 amino acids

MMSTSSDSRSDEGHAACLLNQLDVKVRHLVADSRKLKPGDTFLACAGERHDARNDIPQAIARGVNAIIWEKQGFSWKPEWKIPNLGVAGLRHEAGKIASEAYGHPSRHLWLVGITGTNGKTTCSQWYAQAMAALGKKTAVIGTLGHGFPGALYPSEHTTPDAVYLQQLMAEYLHQGASSLVMEASSHGLSQDRLIGSEFAVAVLTNLTRDHLDYHDSMDAYAAAKAKLFFWEGLQYAVLNLDEVLGVELSQQLAGKDLSIIGYGFKQPRQTAQTAGNQKILYGSNLQFTTQQIGFDVEFCNRYASLQCNVTGRYNAYNLLAVLAALLASNIDLDDAITALRQVQPIPGRMEKLGGGNQPVVIVDYAHTPDALNEVLTGLRETLAGTRIKKRIRKNQAKLICVIGCGGDRDRGKRPLIGEIASRLADEVIITSDNPRNENPADIISEVMLGASGKHCTSEVDRTAAIYRAIHGARKGDIVLIAGKGAETSQEIQGKKYPYDDREVVRQVLHDLAGPELQVQG

56.7 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make murE using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here