Catalyzes the addition of Gal, the second sugar moiety of the O7-antigen repeating unit, to GlcNAc-pyrophosphate-undecaprenol.

Belongs to the glycosyltransferase 2 family.

275 amino acids

MSDDTPKFSVLMAIYIKDSPLFLSEALQSIYKNTVAPDEVIIIRDGKVTSELNSVIDSWRRYLNIKDFTLEKNMGLGAALNFGLNQCMHDLVIRADSDDINRTNRFECILDFMTKNGDVHILSSWVEEFEFNPGDKGIIKKVPSRNSILKYSKNRSPFNHPAVAFKKCEIMRVGGYGNEYLYEDYALWLKSLANGCNGDNIQQVLVDMRFSKETAKRRGGIKYAISEIKAQYHFYRANYISYQDFIINIITRIFVRLLPTSFRGYIYKKVIRRFL

31.9 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make wbbD using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here