Component of the U1 snRNP particle, which recognizes and binds the 5'-splice site of pre-mRNA. Together with other non-snRNP factors, U1 snRNP forms the spliceosomal commitment complex, that targets pre-mRNA to the splicing pathway.

Belongs to the Luc7 family.

264 amino acids

MAAEQRKIIEQLMGSNLSNFTSRGLVHFTDRKVCRSFLCGICPHDIFTNTKMDLGPCPKIHSDKLKSDYERASYSHDYGYEWDYLEDLERHVDDCNKRIDIAEARREKTKEEEERIDELMRDIIHTDHSIEVIITEMEALAKRKLVNDAVKHFIELNRLKTYRKELYDEVISMNEIPSQASTTHQKLQVCDICSAYLSRLDNDRRLADHFSGKMHLGYAMLRNIARDLRAQLEDREKSRDKKDGEKQRDNLASFEDKISTSFVA

30.9 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make usp106 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here