About Products Protein Database Contact

Protein expression services for usp103 | U1 small nuclear ribonucleoprotein C

Description
Component of the spliceosomal U1 snRNP, which is essential for recognition of the pre-mRNA 5' splice-site and the subsequent assembly of the spliceosome. usp103/U1-C is directly involved in initial 5' splice-site recognition for both constitutive and regulated alternative splicing. The interaction with the 5' splice-site seems to precede base-pairing between the pre-mRNA and the U1 snRNA. Stimulates commitment or early (E) complex formation by stabilizing the base pairing of the 5' end of the U1 snRNA and the 5' splice-site region.
Family
Belongs to the U1 small nuclear ribonucleoprotein C family.
Species
Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Length
182 amino acids
Sequence
MPRYLCDYCQVWLTHDSQSVRKAHNAGRAHIQNVQDYYTKVAQEEAQKQLEERASSGFLKKGNGSLDLPYAYAFPPKYNVFNLGCPPPPYIVSANTYMAPKGMNAMNAAAFVPMMPAVNLTNQVAFSAPQTTASSNTQLTQQQQSLPQTNEHQRARTHSNANNHFTKTHHQGQRSHQRFVRA
Mass
20.5 kDa
Simulated SDS-PAGE
Western blot of usp103 recombinant protein(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make usp103 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here