About Products Protein Database Contact

Protein expression services for xerC | Tyrosine recombinase XerC

Description
Site-specific tyrosine recombinase, which acts by catalyzing the cutting and rejoining of the recombining DNA molecules. The XerC-XerD complex is essential to convert dimers of the bacterial chromosome into monomers to permit their segregation at cell division. It also contributes to the segregational stability of plasmids.
Family
Belongs to the 'phage' integrase family. XerC subfamily.
Species
Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
Length
296 amino acids
Sequence
MEKIQQAYLYMLKVEKQFSEHTLKSYHDDLEQFNVFLAQEHLDLNAFEYKDARNYLSYLYSKNLKRTSVSRKISTLRSFYEYWMTQDEAVVNPFIQLVHPKKEHYLPHFFYEEEMEALFDTVENDAKKGLRDRVILELLYSTGIRVSELVHIKEQDIDMTSPGVKVLGKGGKERFIPFGEFCKQSMERYLASFKPKLNSNHDYLLVNMKGDPITERGVRYVLNDVVKRTAGVTEIHPHKLRHTFATHMLNQGADLRTVQSLLGHVNLSTTGRYTHVTNEQLRKVYLNAHPRAKKEN
Mass
34.8 kDa
Simulated SDS-PAGE
Western blot of xerC recombinant protein(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make xerC using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here