Site-specific tyrosine recombinase, which acts by catalyzing the cutting and rejoining of the recombining DNA molecules. The XerC-XerD complex is essential to convert dimers of the bacterial chromosome into monomers to permit their segregation at cell division. It also contributes to the segregational stability of plasmids (By similarity).

Belongs to the 'phage' integrase family. XerC subfamily.

329 amino acids

MPPSAPDDDRDAPAPPHPQIGAYLDALKFERKLSQHTLASYARELAVLQQLGARFAAGIDLMRLQPHHIRRMMAQLHGGGLSGRSIARALSAWRGWYQWLALRDAAVTANPVDGIRAPKSPKRLPKALSVEQAVALMEQLPGDDPEAVRDRAVNELFYSCGLRLSELVGLDLRHAQAGDYASASWLDLEAREVTVLGKGNKRRTVPVGSKAAEALAAWLAVRPQLAQPDAAPEDAHALFLSARGKRLAQRQIQTRMKRNAIAAGVPADVHPHVLRHSFATHMLQSSGDLRAVQELLGHASIASTQVYTSLDFQHLAKIYDQAHPRAKKK

36 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make xerC1 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here