Thionins are small plant proteins which are toxic to animal cells. They seem to exert their toxic effect at the level of the cell membrane. Their precise function is not known.

Belongs to the plant thionin (TC 1.C.44) family.

131 amino acids

MGGGQKGLESAIVCLLVLGLVLEQVQVEGVDCGANPFKVACFNSCLLGPSTVFQCADFCACRLPAGLASVRSSDEPNAIEYCSLGCRSSVCDNMINTADNSTEEMKLYVKRCGVACDSFCKGDTLLASLDD

13.7 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make TTHV using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here