Responsible for the deiodination of T4 (3,5,3',5'-tetraiodothyronine) into T3 (3,5,3'-triiodothyronine). Essential for providing the brain with appropriate levels of T3 during the critical period of development.

Belongs to the iodothyronine deiodinase family.

269 amino acids

MGILSVDLLITLQILPVFFSNCLFLALYDSVILLKHVVLLLSRSKSTRGEWRRMLTSEGMRCIWKSFLLDAYKQVKLGEDAPNSSVVHVSNPEGSNNHGHGTQEKTVDGAECHLLDFANPERPLVVNFGSATUPPFTSQLPAFSKLVEEFSSVADFLLVYIDEAHPSDGWAVPGDSSLSFEVKKHQNQEDRCAAAHQLLERFSLPPQCRVVADRMDNNANVAYGVAFERVCIVQRQKIAYLGGKGPFYYNLQEVRRWLEKNFSKRUKKT

30.4 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make DIO2 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here