Responsible for the deiodination of T4 (3,5,3',5'-tetraiodothyronine) into T3 (3,5,3'-triiodothyronine) and of T3 into T2 (3,3'-diiodothyronine). Plays a role in providing a source of plasma T3 by deiodination of T4 in peripheral tissues such as liver and kidney.

Belongs to the iodothyronine deiodinase family.

244 amino acids

MGLSQLGLWLRRLWVLFQVALQVAVGKVFLILFPSRVKQHIVAMNRKNPHFSYDNWAPTLYSVQYFWFVLKVRWQRLEDRTEPGGLAPNCPVVRLSGQRCSIWDFMKGNRPLVLNFGSCTUPSFLFKFDQFKRLIEDFCSIADFLIIYIEEAHASDGWAFKNNVNIRNHRNLQDRLQAACLLLDRSPRCPVVVDTMKNQSSRLYAALPERLYVLQAGRILYKGKPGPWNYHPEEVRAVLEKLHS

28.5 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make DIO1 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here