Acts as a negative mediator of apoptosis. Suppresses the TNF-mediated apoptosis by inhibiting caspase-8 activity but not the processing of procaspase-8, subsequently resulting in inhibition of BID cleavage and caspase-3 activation (By similarity).

Belongs to the TNFAIP8 family.

198 amino acids

MHFEAEESKEVATDVFNSKNLAVQAQKKILGKMASKSIATTLIDDTSSEVLDELYRVTKEYTQNKKEAEKIIKNLIKTVIKLAILYRNNQFNQDELALMEKFKKKVHQLAMTVVSFHQVDFTFDRNVLSKLLNECREMLHQIIQRHLTTKSHGRVNNVFDHFSDCDFLAALYNPFGNYKPHLQKLCDGINKMLDEENI

23 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make TNFAIP8 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here