Required for the maintenance of microtubule structures and cell polarity. Beta-tubulin-folding protein; may have a regulatory role in the tubulin-folding pathway.

Belongs to the TBCA family.

119 amino acids

MSNTVRSLVIKTNVVKRIIKDVELAHIDINEAEKRVQSKIDNGEDSAEIEHQKFVLKKHLEALPDALVRLRNATNDLESISSDSAYEGTPELEQANEYLEKAKEVIEKEQTNFPTNGYH

13.5 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make alp31 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here