Involved in abiotic stress signaling. Tethered to plasma membrane (PM) and probably bound to phosphatidylinositol 4,5-bisphosphate. Abiotic stresses (drought, salt, H(2)O(2)) trigger phospholipase C mediated PM dislogement and plastidial and nucleocytosolic relocation of TULP3.

Belongs to the TUB family.

406 amino acids

MSFKSLIQDMRGELGSISRKGFDVRFGYGRSRSQRVVQDTSVPVDAFKQSCWASMPPELLRDVLMRIEQSEDTWPSRKNVVSCAGVCRNWREIVKEIVRVPELSSKLTFPISLKQPGPRGSLVQCYIMRNRSNQTYYLYLGLNQAASNDDGKFLLAAKRFRRPTCTDYIISLNCDDVSRGSNTYIGKLRSNFLGTKFTVYDAQPTNPGTQVTRTRSSRLLSLKQVSPRIPSGNYPVAHISYELNVLGSRGPRRMQCVMDAIPASAVEPGGTAPTQTELVHSNLDSFPSFSFFRSKSIRAESLPSGPSSAAQKEGLLVLKNKAPRWHEQLQCWCLNFNGRVTVASVKNFQLVAAPENGPAGPEHENVILQFGKVGKDVFTMDYQYPISAFQAFTICLSSFDTKIACE

45.3 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make TULP3 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here