T1-TrpRS has aminoacylation activity while T2-TrpRS lacks it. T1-TrpRS and T2-TrpRS possess angiostatic activity. T2-TrpRS inhibits fluid shear stress-activated responses of endothelial cells. Regulates ERK, Akt, and eNOS activation pathways that are associated with angiogenesis, cytoskeletal reorganization and shear stress-responsive gene expression (By similarity).

Belongs to the class-I aminoacyl-tRNA synthetase family.

475 amino acids

MADVTNGERCASPQELFSSIAAQGELVKSLKARKAPKEEIDSAVKMLLSLKTSYKEAMGEDYKADCPPGNSTPDSHGDPEAVDDKEDFVDPWTVRTSSAKGIDYDKLIVQFGSSKIDKELVNRIERATGQRPHRFLRRGIFFSHRDMNQVLDAYENKKPFYLYTGRGPSSEAMHVGHLIPFIFTKWLQDVFDVPLVVQMSDDEKYLWKDLTLEQVYGYTLENAKDIIACGFDVNKTFIFSDLDYMGMSPGFYKNVVKIQKHVTFNQVKGIFGFTDSDCIGKISFPAIQAAPSFSNSFPQIFHGQADIQCLIPCAIDQDPYFRMTRDVAPRIGYPKPALLHSTFFPALQGAQTKMSASDPNSSIFLTDTAKQIKTKVNKHAFSGGRDTIEEHRQFGGNCDVDVSFMYLTFFLEDDDKLEQIRKDYSSGAMLTGELKKELIDVLQPLVAEHQARRKEVTDEMVKEFMTPRQLCFHYQ

53.8 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make WARS using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here