The alpha subunit is responsible for the aldol cleavage of indoleglycerol phosphate to indole and glyceraldehyde 3-phosphate. Required for tryptophan biosynthesis. Contributes to the tryptophan-independent indole biosynthesis, and possibly to auxin production.

Belongs to the TrpA family.

312 amino acids

MAIAFKSGVFFLQSPKSQIGFRHSSPPDSSLSFKRFTPMASLSTSSPTLGLADTFTQLKKQGKVAFIPYITAGDPDLSTTAEALKVLDACGSDIIELGVPYSDPLADGPVIQAAATRSLERGTNLDSILEMLDKVVPQISCPISLFTYYNPILKRGLGKFMSSIRAVGVQGLVVPDVPLEETEMLRKEALNNDIELVLLTTPTTPTERMKLIVDASEGFIYLVSSIGVTGARSSVSGKVQSLLKDIKEATDKPVAVGFGISKPEHVKQIAGWGADGVIVGSAMVKLLGDAKSPTEGLKELEKLTKSLKSALL

33.2 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make TSA1 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here