Heme-dependent dioxygenase that catalyzes the oxidative cleavage of the L-tryptophan (L-Trp) pyrrole ring and converts L-tryptophan to N-formyl-L-kynurenine. Catalyzes the oxidative cleavage of the indole moiety.

Belongs to the tryptophan 2,3-dioxygenase family.

393 amino acids

MSCPVGNHNGDPQGGQRLGSEAGMLYGEYLMLDKVLSAQRMLSVESNKPVHDEHLFIVTHQAYELWFKQIIFELDSIRSLFSTEHMEESRTLEILKRLNRIVMILKLLVDQVPILETMTPLDFMDFRDFLSPASGFQSLQFRLLENKLGVKTEHRVKYNQKYSEVFASDPCAIERLSITESEPSLADLVQKWLERTPGLETNGFNFWGKFEESVEQLLADQEASAMEEEHENVKNYRLMDIEKRREVYKSIFDASVHDALVARGDRRFTHRALQGAIMITFYRDEPRFSQPHQLLMLLMDIDSLITKWRYNHVIMVQRMIGSQQLGTGGSSGYQYLRSTLSDRYKVFIDLFNLSTFLIPRGSIPPLTCEMQKALNLAWGSPVHQAKQINYAAK

45.4 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make AAEL000428 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here