Troponin I is the inhibitory subunit of troponin, the thin filament regulatory complex which confers calcium-sensitivity to striated muscle actomyosin ATPase activity.

Belongs to the troponin I family.

single

168 amino acids

KLQLKTLLLQRAKRELEREEQERAGEKQRHLGGLCPPPELEGLGVAQLQELCRELHARIAVDEERYDMGTRVSKNMAEMEELRRRVAGGRFVRPALRRVRLSADAMMAALLGSKHRVGTDLRAGLRQVRKDDAEKESREVGDWRKNVDALSGMEGRKKKFEAPGGGQG

19 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make TNNI3 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here