Catalyzes the sequential condensation of isopentenyl diphosphate (IPP) with geranylgeranyl diphosphate (GGPP) to yield (2Z,6Z,10Z,14Z,18Z,22Z,26Z,30E,34E,38E)-undecaprenyl diphosphate (tritrans,heptacis-UPP). It is probably the precursor of glycosyl carrier lipids.

Belongs to the UPP synthase family.

262 amino acids

MFKEKVGKIILYPVYKFYEKILWNEIKNGPFPQHVGIIPDGNRRWARANNLSINDAYYSGYRKLKQVLLWLLEMGIKNITVFALSTENCDKRSNLELNTIFNYIKAGLEELLYGEIIYKYEVKVRAIGLIYKLPLDLLEVLNQLSKKTENFNKRKLTLAICYGGRQEIIDATKKIIADYEKGKIKLDDINENIFRQYLYDKELEDIDLVIRSSGEIRISNFLLWHIAYSELFFVDTYWPDFRKIDLWRAIRSYQKRKRNFGA

31.1 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make uppS using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here