Involved in protein export. Acts as a chaperone by maintaining the newly synthesized protein in an open conformation. Functions as a peptidyl-prolyl cis-trans isomerase.

Belongs to the FKBP-type PPIase family. Tig subfamily.

436 amino acids

MSIKWEKKDGTNEGKLTFEIAPEKIKEGLNSAFNRVKKSLNVPGFRKGKVPRQIFNKMYGEEALYQEALNDLLPEAYSNAVKEADINPVDQPQIDVESMESDAAWVLTAKVTVEPEVELGQYKDLEVTKHPTRVLKADIENELNRLQQQEAELVLKEDEPAEQGDTVVIDFEGKIDGEAFDGGKGENHSLELGSGQFIPGFEDQLVGHKAGEEVAVTVTFPEDYQAKDLAGKEAVFDTKIHEVKTKELPELDDEFAKDVDEDVATLEELKAKIKDRLKDQKVAEAKAAIQEEALDIAVENATIGEIPAVMIEDDVHRQMDNFLAGMQNQGISADMYYQLTGTSADDLHKQFEEGAEKRVKTNLVLEAIVKAEKIEPSEDEINAEIKSLAEQYQMDEAAVRSALSDDMLKHDIAVRKVVDEIADSAKQTRDAKKDEE

48.6 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make tig using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here