Trichothecene C-3 esterase; part of the core gene cluster that mediates the biosynthesis of trichothecenes, a very large family of chemically related bicyclic sesquiterpene compounds acting as mycotoxins, including T2-toxin (PubMed:11352533, PubMed:12039755). The biosynthesis of trichothecenes begins with the cyclization of farnesyl diphosphate to trichodiene and is catalyzed by the trichodiene synthase TRI5 (PubMed:3800398). Trichodiene undergoes a series of oxygenations catalyzed by the cytochrome P450 monooxygenase TRI4 (PubMed:7651333). TRI4 controls the addition of four oxygens at C-2, C-3, C-11, and the C-12, C-13-epoxide to form the intermediate isotrichotriol (PubMed:16917519). Isotrichotriol then undergoes a non-enzymatic isomerization and cyclization to form isotrichodermol (PubMed:2317042). During this process, the oxygen at the C-2 position becomes the pyran ring oxygen and the hydroxyl group at C-11 is lost (PubMed:2317042). More complex type A trichothecenes are built by modifying isotrichodermol through a series of paired hydroxylation and acetylation or acylation steps (PubMed:11352533). Isotrichodermol is converted to isotrichodermin by the acetyltransferase TRI101 (PubMed:10583973). TRI101 encodes a C-3 transacetylase that acts as a self-protection or resistance factor during biosynthesis and that the presence of a free C-3 hydroxyl group is a key component of Fusarium trichothecene phytotoxicity (PubMed:10583973). A second hydroxyl group is added to C-15 by the trichothecene C-15 hydroxylase TRI11, producing 15-decalonectrin, which is then acetylated by TRI3, producing calonectrin (PubMed:9435078, PubMed:8593041). A third hydroxyl group is added at C-4 by the cytochrome P450 monooxygenase TRI13, converting calonectrin to 3,15-diacetoxyspirpenol, which is subsequently acetylated by the acetyltransferase TRI7 (PubMed:12135578, PubMed:11352533). A fourth hydroxyl group is added to C-8 by the cytochrome P450 monooxygenase TRI1, followed by the addition of an isovaleryl moiety by TRI16 (PubMed:12620849, PubMed:14532047). Finally, the acetyl group is removed from the C-3 position by the trichothecene C-3 esterase TRI8 to produce T-2 toxin (PubMed:12039755).

Belongs to the AB hydrolase superfamily. Lipase family.

447 amino acids

MALNRLVFSLSLWLGFIGAAQAASSEPLPPSKDPWYTAPPGFESAEPGTVLRVRPAPGNLTSITANSSASYNILYRTTDSHFKPTWAVTTLLVPELGPDSLAQQKFQQSALLSFQVPYDSADVDASPSYSMYSASNDSSAPYTAALGSGLFVSVPDYEGPLAAFTAGIISGYATLDSIRAVLSLGLGLNITNSPRAALWGYSGGAFATEWASELAVQYAPDLVAGPVVGAAMGAPLANITTFMHSVNGQATSGLVPNTLLGLTSQYPDVRKYLVSKLNDDSEYNRTGFLAAEGFTVTESGVAFAGIDINKYFQNGTDILNDPKILALVNREGIMGYHGVPKWPLFIYQAIPDEVTPISATDALVEKYCAVGADILYERNTVGSHYEETNNSYKAAVQWLEDVFSSQHDINRAQGCVIQDVTRNTTSGDLVRRKDVQKSVFDLWSAAW

47.9 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make TRI8 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here