Required for the transposition of the insertion element.

Belongs to the transposase IS21/IS408/IS1162 family.

507 amino acids

MINVAILSAIRRWHFRDGASIREIARRSGLSRNTVRKYLQSKVVEPQYPARDSVGKLSPFEPKLRQWLSTEHKKTKKLRRNLRSMYRDLVALGFTGSYDRVCAFARQWKDSEQFKAQTSGKGCFIPLRFACGEAFQFDWSEDFARIAGKQVKLQIAQFKLAHSRAFVLRAYYQQKHEMLFDAHWHAFQIFGGIPKRGIYDNMKTAVDSVGRGKERRVNQRFTAMVSHYLFDAQFCNPASGWEKGQIEKNVQDSRQRLWQGAPDFQSLADLNVWLEHRCKALWSELRHPELDQTVQEAFADEQGELMALPNAFDAFVEQTKRVTSTCLVHHEGNRYSVPASYANRAISLRIYADKLVMAAEGQHIAEHPRLFGSGHARRGHTQYDWHHYLSVLQKKPGALRNGAPFAELPPAFKKLQSILLQRPGGDRDMVEILALVLHHDEGAVLSAVELALECGKPSKEHVLNLLGRLTEEPPPKPIPIPKGLRLTLEPQANVNRYDSLRRAHDAA

58 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Have you tried producing istA in a cell-free protein expression systems? We have solved cell-free protein expression scale-up and purification challenges so that you can obtain up to low-milligram quantities of proteins in hours.

Order Here