Involved in the normal targeting of ventral muscle, muscle 12, by motoneurons. May function as an axon guidance molecule involved in neuromuscular specificity.

321 amino acids

MFHSLVLMACALAALSVAQGAGSARSKSLPLSLSLSVSVSSSLASASSPGAAADPTAAFTVTATAPTPASAPFAGKQLNRCRQSCYQQLSKDWHYCKDSVDCTNCCQKLVAPFELRILKAQRQESLVLTDIGWDEMIANASRQCLITWEVSGGGLIGNLLTDTARAELSLWPDTVYNIQVKCKHKLTGLMRRSIKLNVDTSQLVGTTTTTTTSKSSIQRQHLEQPVDHTDALEHSQHIRIPRPTDRVYIISALPTPSELGGVVYPAFGALAFFLALLVMFLFLRPQRKRFPLDADSADTATLIGRSSSSSRNSMDASTLHV

34.6 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make fend using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here