About Products Protein Database Contact

Protein expression services for Tmem64 | Transmembrane protein 64

Description
Positively regulates TNFSF11-induced osteoclast differentiation. Acts as a regulator of TNFSF11-mediated Ca(2+) signaling pathways via its interaction with SERCA2 which is critical for the TNFSF11-induced CREB1 activation and mitochondrial ROS generation necessary for proper osteoclast generation. Association between TMEM64 and SERCA2 in the ER leads to cytosolic Ca (2+) spiking for activation of NFATC1 and production of mitochondrial ROS, thereby triggering Ca (2+) signaling cascades that promote osteoclast differentiation and activation (PubMed:23395171). Negatively regulates osteoblast differentiation and positively regulates adipocyte differentiation via modulation of the canonical Wnt signaling pathway. Mediates the switch in lineage commitment to osteogenesis rather than to adipogenesis in mesenchymal stem cells by negatively regulating the expression, activity and nuclear localization of CTNNB1 (PubMed:25979161).
Family
Belongs to the TVP38/TMEM64 family.
Species
Mus musculus
Length
381 amino acids
Sequence
MRNPGGSLPHTLPRALQHAGRTGVVEQPGRWAPERTAGGDRSEDRLPRGGGASAAAAAAAAAASGALLGAYLERHGLPAASDLPAPAGALAGGPGSGGGVVVGVAEVRNWRCCCLGSTCWCRSLVLVCVLAALCFASLALVRRYLQHLLLWVESLDSLLGVLLFVVGFIVVSFPCGWGYIVLNVAAGYLYGFVLGMGLMVVGVLIGTFIAHVVCKRLLTAWVAARIQNSDKLSAVIRVVEGGSGLKVVALARLTPIPFGLQNAVFSITDVPLPSYLMASSAGLLPTQLLNSYLGTTLRTMEDVIAEQSLSGYFVFCLQIVISIGLMFYVVHRAQVELNAAIVACEMELKTSLVKGNQSDPSGSSFYNKRTLTFSGGGINIV
Mass
39.8 kDa
Simulated SDS-PAGE
Western blot of Tmem64 recombinant protein(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make Tmem64 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here