Modulates the O-glycosylation and complex N-glycosylation steps occurring during the Golgi maturation of APP. Inhibits APP transport to the cell surface and further shedding (By similarity).

Belongs to the TMEM59 family.

331 amino acids

MAAVALPLLLLLASPATPTPARDPFSPQLGDTQRCQQRCRQRHPGLPPAQPEPEGPSESPNNKAVLINACERGCRLFSICRFVARSSRPNATETECEAACTEAYVKAKEQQACSEGCWGQIPEPETQLEQKELALDPPSGSLSLRHLFTMLCSDLMSSAQDLISSTWTYSLQTDNRKTQPVVENFAFQGSRLQRVEVTWRGSHPKALEVHMDPMSPLEKVRRAKPHLKTSKAKVESEDQQESDFLSCMSRRSGLPRWVLFCCLFLSVLIILWLSCCTLVTTPGQHLKFQPLTAEQHKGLLVESNWPLYPPLPPAYEDSPPPYKLKLDLTTL

37 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make Tmem59l using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here