Part of the tectonic-like complex which is required for tissue-specific ciliogenesis and may regulate ciliary membrane composition.

160 amino acids

MADVCLRLQYACPWQSNMAAHGRQPVLSSTPLQILFHLNGWYFAAFFVAEILMFIYKGVILPYPQDNLILDVVLLLLFSGLETLRLFYGWKGNLCQRSLALFVSVAILVPCAVLSVYYLLLQTFVLRLEFVLNAVLLCFYGFELVLGVMTISIFSRANIY

18.2 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make tmem216 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here