May define a distinct membrane domain in the vicinity of the mitotic spindle. Involved in the organization of the nuclear envelope implicating EMD, SUN1 and A-type lamina. Involved in nuclear movement during fibroblast polarization and migration. Proposed to be involved in actin-dependent nuclear movement via association with transmembrane actin-associated nuclear (TAN) lines which are bound to F-actin cables and couple the nucleus to retrograde actin flow. May recruit Ran GTPase to the nuclear periphery.

Belongs to the TMEM201 family.

393 amino acids

MEGVSALLARCPTAGLAGGLGVTACAAAGVLLYRIARRMKPTHTVVNCWFCNQDTVVPYGNRNCWDCPHCEQYNGFQENGDYNKPIPAQYLEHLNHVVSGSPGPRAPAQPLQWVSSQVLLCRRCSHHQTAKVKQLAAFSPRDEGRYDEEIEVYRHHLEQMYKLCRPCQAAVEHYIKHQNRQLRALLLSHQFKRREADQTHTQSFCASAVKAPAQVIVLRALAFLACAFLLTTALYGTSNPFAPGAPLPPTLPTGSNGSAPPDNGTATGAEGWRQLLGLLPEHAAEKLREAWAFGQSHQMGVVALGLLTCLLAMLLAGRIRLRRIDAFSTGLWALLLGLHLAEQYLQAASPSWLDTLKFSTTSLCCLVGFTAAVATRKATGPRRFRPRRSEKQQ

43.2 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make TMEM201 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here