Transmembrane component of the tectonic-like complex, a complex localized at the transition zone of primary cilia and acting as a barrier that prevents diffusion of transmembrane proteins between the cilia and plasma membranes. Required for ciliogenesis and sonic hedgehog/SHH signaling (By similarity).

Belongs to the TMEM17 family.

219 amino acids

MPVFYTPIPQNLRVGLANVSGSVFINNRTRDSADFKDHYLENEACAEVSSHLPLQMMLYFNMFFFPFWWISELLMLQLKFSYLPVYYQCLLVTGMVLISIFEVLRMYLGYAGNLKEKVPELAGFWLISFLFQLPILLFFITDPDIIILPLERAVHSLYLAFLLGELMASFLALRVMTRKLAQQFHMRQFGHVQGLHTAEALPMFGLPYGGRSVLPVQDI

25.3 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make tmem17a using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here