Description
Plays an important role in bone formation and normal bone mineralization (PubMed:26207632, PubMed:22416756, PubMed:20025746). Promotes the differentiation of myoblasts into osteoblasts (PubMed:22416756, PubMed:20025746, PubMed:22579779). May induce the commitment and differentiation of myoblasts into osteoblasts through an enhancement of BMP2 production and interaction with the BMP-RUNX2 pathway (PubMed:21239498, PubMed:22579779). Upregulates the expression of ATF4 which plays a central role in osteoblast differentiation (PubMed:24362451). Essential for normal spermatogenesis and late testicular differentiation (PubMed:26207632).
Sequence
MVPWFLLSLLLLARPVPGVAYSVSLPASFLEDVAGSGEAEGSSASSPSLPPPGTPAFSPTPERPQPTALDGPVPPTNLLEGIMDFFRQYVMLIAVVGSLTFLIMFIVCAALITRQKHKATAYYPSSFPEKKYVDQRDRAGGPRTFSEVPDRAPDSRHEEGLDTSHQLQADILAATQNLRSPARALPGNGEGAKPVKGGSEEEEEEVLSGQEEAQEAPVCGVTEEKLGVPEESVSAEAEGVPATSEGQGEAEGSFSLAQESQGATGPPESPCACNRVSPSV
Simulated SDS-PAGE

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service