A translational regulator that binds mRNA to regulate translation initiation and/or mRNA stability. Usually binds in the 5'-UTR at or near the Shine-Dalgarno sequence preventing ribosome-binding, thus repressing translation. Binds mRNA; 77% of enriched bound RNA is for flagellin A (flaA) while another 13% encodes other flagellar or motility-related genes. Binds mRNA in 5'-UTR or intergenic regions, binds consensus 5'-AAGGA-3' in the loop of a predicted stem-loop structure. Binds at least 2 sites in the 5'-UTR of flaA mRNA and represses its translation; mutation of the binding sites abolishes binding and leads to increased amounts of FlaA protein. Translation repression is antagonized by FliW, probably by its direct binding to CsrA, which allows translation of FlaA and probably other flagellar proteins (PubMed:27229370). Influences the localization of flaA transcripts to poles of short, probably elongating, cells.

Belongs to the CsrA/RsmA family.

75 amino acids

MLILSRKENESIIIGEGIEIKVVQTGKGYAKIGIEAPKSLMILRKELVQQVKDENLHSVVQNDIKLDDLSKKLIK

8.4 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make csrA using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here