About Products Protein Database Contact

Protein expression services for csrA | Translational regulator CsrA

Description
A key translational regulator that binds mRNA to regulate translation initiation and/or mRNA stability. Mediates global changes in gene expression, shifting from rapid growth to stress survival by linking envelope stress, the stringent response and the catabolite repression systems. Usually binds in the 5'-UTR; binding at or near the Shine-Dalgarno sequence prevents ribosome-binding, repressing translation, binding elsewhere in the 5'-UTR can activate translation and/or stabilize the mRNA. Its function is antagonized by small RNA(s).
Family
Belongs to the CsrA/RsmA family.
Species
Acinetobacter baumannii (strain AYE)
Length
84 amino acids
Sequence
MLILTRRVGETLMIGDQVSVTVLGVKGNQVRIGVNAPKEVSVHREEIYQRIQHERAMHEHLQHLDQDYQVSYEDDNYAQKNFNR
Mass
9.8 kDa
Simulated SDS-PAGE
Western blot of csrA recombinant protein(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make csrA using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here