About Products Protein Database Contact

Protein expression services for csrA | Translational regulator CsrA

Description
A translational regulator that binds mRNA to regulate translation initiation and/or mRNA stability. Usually binds in the 5'-UTR at or near the Shine-Dalgarno sequence preventing ribosome-binding, thus repressing translation. Its main target seems to be the major flagellin gene, while its function is anatagonized by FliW.
Family
Belongs to the CsrA/RsmA family.
Species
Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372)
Length
75 amino acids
Sequence
MLVLTRKKNESIIINDNIEITVVDIQGEQVRIGINAPKSISIYRKEIYLEIQAENKKAAEIKNVDLKEDLKDFLK
Mass
8.7 kDa
Simulated SDS-PAGE
Western blot of csrA recombinant protein(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make csrA using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here