Chloroplast translation initiation factor that is essential for the coordination of leaf and chloroplast development (PubMed:27535792). IF-3 binds to the 30S ribosomal subunit and shifts the equilibrum between 70S ribosomes and their 50S and 30S subunits in favor of the free subunits, thus enhancing the availability of 30S subunits on which protein synthesis initiation begins (By similarity).

Belongs to the IF-3 family.

281 amino acids

MAGITSTVGFNAILAGATKTVSHPVKSKLFGLRLCVPEFSIVSLSPYHHRRCPAITCRYGGGGGGGSRFPGDRRGRQKESEDDDSLDISAIRSATVRLIDDQQNMIGLVSKEEAVRRAEDAELDLVILSPDADPPVVRMMDYSKYRYEQQKRKKEQQKKTTRMDLKELKMGYNIDQHDYSVRMRAARKFLQDGDKVKVIVNMKGRENEFRNIAIELLRRFQTEIGELGTEESKNFRDRNLFIVLVPNKEVIRKVQEPPPKKKKKPADDKVSAANITATQDI

31.8 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make IF3-4 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here