Protein expression services for aruR | Transcriptional regulatory protein AruR
Description
Member of the two-component regulatory system AruS/AruR, which is involved in the regulation of the arginine transaminase (ATA) pathway in response to exogeneous L-arginine. Regulates transcription of aruH and aruI.
Species
Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Length
244 amino acids
Sequence
MAMVPRVLVVDDDPVIRELLQAYLGEEGYDVLCAGNAEQAEACLAECAHLGQPVELVLLDIRLPGKDGLTLTRELRVRSEVGIILITGRNDEIDRIVGLECGADDYVIKPLNPRELVSRAKNLIRRVRHAQASAGPARQALRQFGDWLLDADRRRLIDHAGNETLLTHGEFQLLGAFLRNSGHTLSRDQLMDQIRNREWLPSDRSIDVLVGRLRRKLRDDPAEPQLIITIHGAGYLFTAAASDA
Mass
27.2 kDa
Simulated SDS-PAGE
(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make aruR using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)
Order Here