The promoter for a critical alginate biosynthetic gene, AlgD, encoding GDP-mannose dehydrogenase, is activated only under conditions reminiscent of the cystic fibrosis lung (i.e. under high osmolarity), and at least two regulatory genes, AlgP and AlgQ, have been implicated in this activation process.

Belongs to the Rsd/AlgQ family.

160 amino acids

MLESCRNAQERWGGVHQLIDRWLHERQQLVQAFDALSGIQAPAPNAEELQHFCQLLLDYVSAGHFEVYEQLTAEGKAFGDQRGLELAKQIFPRLEAITESALNFNDRCDNGDCREGACLIAELKVLRQQLHERFELEDCLIEVLHNAHSQSGAEGSAVPV

18 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make algQ using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here