Functions as an OHLL responsive transcriptional regulator that acts in virulence (soft rot disease) through the activation of genes for plant tissue macerating enzymes.

Belongs to the autoinducer-regulated transcriptional regulatory protein family.

250 amino acids

MSISFSNVDFINSTIQSYLNRKLKSYGDPKYAYLIMNKKKPTDVVIISNYPTEWVDIYRNNNYQHIDPVILTAINKISPFSWDDDLVISSKLKFSRIFNLSKDYDIVNGYTFVLHDPGNNLAALSFMIEEHRSEELEEIIQNNKDKLQMLLISAHEKLTSLYREMSRNRNNSKSQEADLFSQRENEILHWASMGKTYQEIALILGITTSTVKFHIGNVVKKLGVLNAKHAIRLGVEMNLIKPVGPAKARS

28.7 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make expR using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here